PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 902030
Common NameARALYDRAFT_902030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 102aa    MW: 12380.2 Da    PI: 10.8074
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
902030genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.71.3e-083575345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++T++E++l+ + +++ G + W++Ia ++  gR +k++  +w 
           902030 35 NMTEQEEDLIFRMHRLVGDR-WDLIAGRVV-GREAKDIERYWI 75
                     68****************99.*********.***********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007174.6E-53280IPR001005SANT/Myb domain
CDDcd001671.61E-53574No hitNo description
PfamPF002494.8E-83575IPR001005SANT/Myb domain
SuperFamilySSF466891.06E-63675IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-103675IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:1900033Biological Processnegative regulation of trichome patterning
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 102 aa     Download sequence    Send to blast
MDNTNRLRPL RSPKQTKFTL RYSEEVSSVK WEFTNMTEQE EDLIFRMHRL VGDRWDLIAG  60
RVVGREAKDI ERYWIMRNCD HCSHKRRRRF HKLSRFSISP P*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17688RNCDHCSHKRRRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0026856e-54CP002685.1 Arabidopsis thaliana chromosome 2, complete sequence.
GenBankFJ9726776e-54FJ972677.1 Arabidopsis thaliana ecotype Gr-1 trichomeless2 (TCL2) gene, complete cds.
GenBankFJ9726796e-54FJ972679.1 Arabidopsis thaliana ecotype Oy-0 trichomeless2 (TCL2) gene, complete cds.
GenBankFJ9726806e-54FJ972680.1 Arabidopsis thaliana ecotype Landsberg erecta trichomeless2 (TCL2) gene, complete cds.
GenBankFJ9726816e-54FJ972681.1 Arabidopsis thaliana ecotype Col-0 trichomeless2 (TCL2) gene, complete cds.
GenBankU932156e-54U93215.3 Arabidopsis thaliana chromosome 2 BAC T6B20 genomic sequence, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002881109.15e-71hypothetical protein ARALYDRAFT_902030
SwissprotB3H4X89e-60TCL2_ARATH; MYB-like transcription factor TCL2
TrEMBLD7LC515e-71D7LC51_ARALL; Putative uncharacterized protein
STRINGscaffold_401531.12e-70(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM32328194
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30424.15e-61MYB_related family protein